PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.H04061.1.p
Common NameEUGRSUZ_H04061
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family WRKY
Protein Properties Length: 369aa    MW: 41389.2 Da    PI: 6.8006
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.H04061.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.99e-33182239158
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                       ldDgy+WrKYGqK vk+s++prsYYrCt+agC vkk+vers+ed ++v++tYeg+H+h
  Eucgr.H04061.1.p 182 LDDGYRWRKYGQKAVKNSPYPRSYYRCTTAGCGVKKRVERSSEDSSTVVTTYEGQHTH 239
                       59******************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.3E-34167242IPR003657WRKY domain
SuperFamilySSF1182905.89E-29174241IPR003657WRKY domain
PROSITE profilePS5081132.374177242IPR003657WRKY domain
SMARTSM007743.8E-39182241IPR003657WRKY domain
PfamPF031061.9E-26183239IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MEEKDQPHHH HHHHHHHRQQ QQQQQQNQDR YPQQQRNRMM VDAPSMANSL FADEPTMINY  60
NIFDMPSDEH LPGAAGTPSP SSQQQQQQQQ QPLLSPASTV PETSSELVNN PATPNSSSVS  120
LSSNEAAGND EEEREANKAG EEEEEEQNQD KSKKQLKPKK KNQKRQREPR FAFVTKSEVD  180
HLDDGYRWRK YGQKAVKNSP YPRSYYRCTT AGCGVKKRVE RSSEDSSTVV TTYEGQHTHL  240
SPATTKSGLG IIQSEAAASY CGGLPATAAS FLIPDHYNHQ QLQPLNVPYA FTSRPSNLSL  300
LTSTTTTTTS EPHRFSSSFL RFYEEKPFVA VPSSTSSSSG LDLARDHGLL QDVIVPSQLR  360
NKQEPKEE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-301752431078Probable WRKY transcription factor 4
2lex_A4e-301752431078Probable WRKY transcription factor 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.H04061.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010024807.10.0PREDICTED: probable WRKY transcription factor 23
TrEMBLA0A059B5120.0A0A059B512_EUCGR; Uncharacterized protein
STRINGPOPTR_0010s15750.11e-75(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61522647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47260.14e-45WRKY DNA-binding protein 23